PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016443705.1
Common NameTERN
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family NAC
Protein Properties Length: 229aa    MW: 26352 Da    PI: 9.0095
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016443705.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1454.2e-4551352128
             NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk....kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkev 92 
                      pGfrF Pt+eel+++yL +k+egk+ el++vi+ v iy+++Pw+Lp+     + +++++w+fF++r++++a+g r+ r+t+sgyWkatg+ + v
  XP_016443705.1   5 SPGFRFYPTEEELISFYLLNKLEGKRPELDRVIPVVTIYNLDPWHLPNlpgeLCMGDTEQWFFFVPRQEREARGGRPCRTTTSGYWKATGSPTYV 99 
                     69***************************999**************9657763334677************************************ PP

             NAM  93 lskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                     +s++++++g+kk++vfykg+ap+g+kt+W m+eyr+
  XP_016443705.1 100 YSSESKVIGVKKSMVFYKGKAPTGRKTKWKMNEYRA 135
                     **********************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019419.02E-493161IPR003441NAC domain
PROSITE profilePS5100547.7744163IPR003441NAC domain
PfamPF023651.3E-236134IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 229 aa     Download sequence    Send to blast
MVEISPGFRF YPTEEELISF YLLNKLEGKR PELDRVIPVV TIYNLDPWHL PNLPGELCMG  60
DTEQWFFFVP RQEREARGGR PCRTTTSGYW KATGSPTYVY SSESKVIGVK KSMVFYKGKA  120
PTGRKTKWKM NEYRAIEQET STSSSFSIPK LRHEMSLCRV YVISGSFRAF DRRPVATVTR  180
DTAAVKIQEL AGDRDNISSA ISVKNESKSY NIVESDFENL NGWEQINWM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B1e-36216115163NAC domain-containing protein 19
4dul_A1e-36216115163NAC domain-containing protein 19
1ut7_B1e-36216115163NO APICAL MERISTEM PROTEIN
1ut7_A1e-36216115163NO APICAL MERISTEM PROTEIN
1ut4_B1e-36216115163NO APICAL MERISTEM PROTEIN
1ut4_A1e-36216115163NO APICAL MERISTEM PROTEIN
3swp_D2e-36216118166NAC domain-containing protein 19
3swp_C2e-36216118166NAC domain-containing protein 19
3swp_B2e-36216118166NAC domain-containing protein 19
3swp_A2e-36216118166NAC domain-containing protein 19
3swm_D2e-36216118166NAC domain-containing protein 19
3swm_C2e-36216118166NAC domain-containing protein 19
3swm_B2e-36216118166NAC domain-containing protein 19
3swm_A2e-36216118166NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0211780.0AB021178.1 Nicotiana tabacum TERN mRNA for NAC-domain protein, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009759500.11e-172PREDICTED: NAC domain-containing protein 90
RefseqXP_016443705.11e-172PREDICTED: NAC domain-containing protein 90
SwissprotQ9FMR33e-85NAC90_ARATH; NAC domain-containing protein 90
TrEMBLQ9SXQ01e-171Q9SXQ0_TOBAC; NAC-domain protein
STRINGPGSC0003DMT4000677071e-120(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA24942357
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G22380.11e-86NAC domain containing protein 90